DPCstruct | MC26964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 137 ± 14 aa |
| Standard deviation of domain lengths | 13.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W3QRJ0 | 110-243 | TIGLCTEVDVKGEPDPGDVDPISVEPLQSQQWVLAAIARLGFKIKNVTFQQSKLRGLPQQLPFHQEIHLSPPPQFQGRLAQVGLTFV… |
| A0A135I6W5 | 1-132 | MAKDANTTLPLTIVPSSALESSLSAFESLGFRIEKETTEQPKKGQHPFEQTFTLAPINAPYNAHWSSLTMVASADDGTLSLSLRFSI… |
| A0A1V1PAZ0 | 86-228 | None |
| A0A2D5SZ42 | 61-194 | None |
| A0A2R6G900 | 1-105 | None |
| I3TU86 | 2-139 | None |
| A0A5D4SW28 | 23-171 | None |
| A0A841TTY7 | 17-162 | None |
| A0A285GPD6 | 8-160 | None |
| D1A5J6 | 66-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.