DPCstruct | MC26963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 13.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645FZ90 | 1-129 | MLLQVTAFVRIGAGQEVFPSQELILDRGRGDKSKTLYHVSNIAGIHSQKIGNALRTIDTWYEGADEMGPIAVEPYGSVTTQGKAYRQ… |
| A0A135I3D1 | 19-159 | WLADIKANVSASFMQEIFPSQLFSDAKDGSNLGREYAKVRSGDGQIWPSLNAEKIGAAIQLIDDWWADEADKRLRVHEYGGDKKYHI… |
| N8PWM2 | 86-234 | None |
| A0A5C4Q025 | 2-107 | None |
| U7UQX7 | 196-313 | None |
| A0A6N8EJ92 | 154-272 | None |
| A0A4S8F9N2 | 35-164 | None |
| A0A3S4E3Y5 | 32-180 | None |
| A0A401X792 | 235-356 | None |
| A6FFZ7 | 160-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.