DPCstruct | MC26959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 10.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A382BKB9 | 3-94 | NTVKTEIIPSESWNGFTYVFSNGWSVSVQQSDAHYCTVGKTAEVAIFDPENNWYTYDEEKNEILISKEDTHVNGWLNADQVAKIISI… |
| A0A0F9MEL7 | 1-90 | MIGFKICDDKGFHIGLRNGFTVSVQFGRGNYCEHHHDSNWGKPNKGSSFDAETAVFSPKDDLIPVNGDSVQGWQTPDDVVLLLAIVA… |
| A0A6M3LNV7 | 1-85 | None |
| A0A382UKW8 | 1-114 | None |
| A0A2A4P6P2 | 1-116 | None |
| A0A0F9H2X3 | 1-98 | None |
| A0A0F9Q856 | 2-92 | None |
| A0A169E1C2 | 1-108 | None |
| A0A3D2RZV9 | 13-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.