DPCstruct | MC26954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 12.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5IAU9 | 3-121 | KFKQIETEIWVANLEKPGYLKMERKKTVQEVFDELVTVLKEQEVYGEMDYFQISVGNDKKGDFPVFRWIACFAVEGGSEGHYIHIEV… |
| A0A3A8YUZ2 | 54-188 | DPKIKVRVCHETRETLMRGIHQMAVDSGHYAKAKAILDYFLPDTWGSPTEFSCNEFTFVANVSFGNNEGIYLNCYAEGKTQIDGGEV… |
| A0A3M1ECV8 | 1-127 | None |
| A0A415ZKP6 | 7-112 | None |
| A0A1E3UA97 | 1-136 | None |
| A0A1H0F0E9 | 14-126 | None |
| R5GSR2 | 22-159 | None |
| A0A1I2Y4V9 | 1-105 | None |
| A0A7X5IYS8 | 1-135 | None |
| A0A433CAX7 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.