DPCstruct | MC26949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 157 ± 18 aa |
| Standard deviation of domain lengths | 18.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4U2Z1 | 40-221 | KKKKPITQSCPQCHLVHHLQNNSTEQPFVSSSPRHIIFLLIIPLLIGLLQVDYQNKSVSPFDTHPVNMWISFGAAFIYCLGLAINVE… |
| A0A6N2MUJ6 | 394-539 | MSNILVQHAIFAVLVETLINQIKVKYQSMPVSPFETHKRVMSAFFVALFIYATASVAEVILWTQKSVHQRLVGNIRLFASALATTLL… |
| A0A498KKG5 | 294-435 | None |
| A0A7N2MZC9 | 1-201 | None |
| A0A2J6KQU3 | 1-141 | None |
| A0A2P5DSD3 | 3-149 | None |
| B9MUW4 | 2-163 | None |
| A0A6P6TNI4 | 1-165 | None |
| A0A438DCU3 | 165-351 | None |
| A0A5J5U7Y4 | 99-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.