DPCstruct | MC26948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 170 ± 21 aa |
| Standard deviation of domain lengths | 20.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D2HVE9 | 524-675 | GIIAEDPVQLQISGTFFLGDAFILLKSMSGVVKGINIVDNMFSGSGNGVPIVKLDESRKAFHDVDQVVVDRNSVNGMAMKSTVAKGS… |
| V4U2D0 | 18-172 | GIVAEDPVQLHISSSFFLGDAFIVLKSINGVAKGVYIVDNLFSGKNNGVEIVKLDQSNGAFKQIDKVFVDRNTVQGMNTRATIARAS… |
| S9QY65 | 329-532 | None |
| A0A7S1JYD7 | 79-233 | None |
| A0A3S3N594 | 21-176 | None |
| M4DWP4 | 459-610 | None |
| A0A843H9A4 | 455-627 | None |
| A0A662RV21 | 397-581 | None |
| A0A6L2NQI9 | 630-787 | None |
| A0A0G0MAH3 | 184-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.