DPCstruct | MC26944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 195 ± 27 aa |
| Standard deviation of domain lengths | 26.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6K429 | 5-196 | ATRAAFRAACATFVNQIEDIEKDGNDFQTRVDADEAQWSEVDEDTGIGFDYGDELAERRFEAEEALSTLRKAFAILAYHQWERGALS… |
| A0A6I4M0Z0 | 14-225 | RDRLIATHEFYVAEAKSRLLAQFNDEAMKADADCHAEAWLAGRAQHFDPERDDPAAAYEQSWDEAVAFYQSLVDLQKTTRLSIVAGM… |
| A0A2H5F0U0 | 1-170 | None |
| A0A6J5F3J1 | 10-161 | None |
| A0A2D5P2V9 | 2-183 | None |
| A0A829I5D6 | 2-146 | None |
| A0A7G9SF31 | 23-224 | None |
| A0A7S7RN92 | 1-209 | None |
| A0A439RJR1 | 55-275 | None |
| A0A1S2F9Q5 | 3-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.