DPCstruct | MC26943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 140 ± 23 aa |
| Standard deviation of domain lengths | 23.04 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7MXE5 | 18-132 | NNFSNKYIPLTRTYYSINELRKNPPDADMYIAGSDQIWNTTFRNGTDSAYYLDFGLKDTRRESFAASFATEHLVPSAYEFVKENLKR… |
| A0A1Y2AKS6 | 251-384 | TQFINENIFSGGINGFNVNINKLKALNKYYDNFVVGSDQVWRYHIEETYMINFLSFVEKNKNKISCASSFGVDHWEGSRKLIRKIRK… |
| A0A4Y5STL5 | 205-348 | None |
| A0A448Y3F7 | 199-332 | None |
| A0A5C8EIC2 | 349-508 | None |
| A0A096B6G0 | 53-232 | None |
| A0A292QZ20 | 328-450 | None |
| A0A0K8P981 | 605-709 | None |
| A0A6A7VL73 | 2-130 | None |
| A0A2Z4UC60 | 133-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.