DPCstruct | MC2694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 222 ± 34 aa |
| Standard deviation of domain lengths | 33.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF00032- CL0328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350BP61 | 13-231 | APLEEPANRALTPNPSKAPWYFLGLQEMLVYFDPWIAGVVLPTLIIVGLMAIPYIDINEKGNGYYTFKERKFAVLTYVFGFHVLWVL… |
| A0A6J4X304 | 107-307 | ATIPNLIVRELVVAAVLIALILHFSILFNAPLETKANPGLSPNPTKAPWYFAGLQELLLYFHPLFAVLVIPAVIVGMLFLLPFIRYD… |
| A0A3M2BS82 | 85-320 | None |
| A0A1G0SM69 | 43-300 | None |
| A0A2H0LCM3 | 290-505 | None |
| A0A7C4PTC0 | 264-458 | None |
| A0A2D6N5L7 | 122-347 | None |
| A0A535XTA1 | 85-341 | None |
| A0A3M1BK51 | 37-246 | None |
| A0A1E4HWD1 | 278-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.