DPCstruct | MC26937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 94 ± 15 aa |
| Standard deviation of domain lengths | 15.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662I6Y0 | 17-113 | CSPIHVFSQYLSSSQQRKFLVYLDNFLRENRVLFSYPVFGLYMSPWEENEAKTLSWREVCWVNVFGEERCGFPVYDSLAPEFQTYET… |
| A0A497JWX2 | 54-145 | DIPIFAFIDWAATSNTPLGRFSQSLTKEQQREFLKIADEFFREKDVIFVYPVHGGTMGIDAHILSFGKSRVYDALAPEFQTYKTIRE… |
| A0A7J2LVA7 | 62-159 | None |
| A0A284VLT9 | 746-826 | None |
| A0A497NEJ2 | 506-635 | None |
| A0A497IYF3 | 1-69 | None |
| A0A662U0D1 | 214-297 | None |
| A0A662VEH2 | 95-189 | None |
| A0A5E4KPT5 | 140-223 | None |
| A0A7J2LV70 | 785-914 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.