DPCstruct | MC26932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 125 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662HWH3 | 12-122 | EVKSLSKDFTEEFISRLLENFQVIAPVRKDGRIFYERIADPHEVDLEYTGRSQLPPKRFFFPEKEVLFTYEVTAEGVLIYDRSEELE… |
| A0A662L5R1 | 4-127 | EICRLEKDDFLAFVDNLINGFETIGVKEKRGRFVFSHLESAAELRLDHDVTILPPKKNFLPPYEKMIKFNVGEQKGELLGDNTKRVI… |
| A0A7J3QAY1 | 1-134 | None |
| A0A7V5EA84 | 132-251 | None |
| A0A5C1T244 | 1-138 | None |
| G2DGY1 | 35-165 | None |
| A0A7C2QYS4 | 1-127 | None |
| F7KYC8 | 1-131 | None |
| A0A7V1EK88 | 14-119 | None |
| A0A4Q0MRE1 | 8-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.