DPCstruct | MC26931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 135 ± 16 aa |
| Standard deviation of domain lengths | 15.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.40 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0475- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662HSU3 | 3-127 | FEVTDAENALVIKARGLLSRRNILDLYSYVASNLISLNNLNSPAIELRGGILRLQALDEGFISITGYGNIIVNEEIYGNWITIPVGP… |
| A0A7X1W426 | 2-125 | IKVLKPGLATSVQDLGREGYYHLGIPPSGALDQYALSAANQLVGNPAGAAALECTLLGPELEFQQDALVAVSGAHMTPRLDGIEMHP… |
| A0A1E3WBI6 | 129-258 | None |
| A0A2V8X5I8 | 45-150 | None |
| A0A2P9HYH8 | 98-243 | None |
| A0A6N8FBN6 | 526-688 | None |
| A0A239IS16 | 20-151 | None |
| A0A5E5QVR4 | 2-101 | None |
| A0A133ZM80 | 220-372 | None |
| A0A6J4Y7E1 | 6-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.