DPCstruct | MC2693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 172 ± 19 aa |
| Standard deviation of domain lengths | 18.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y3H259 | 2-167 | FHQMRASQFMTWPEELLRSYRSDLQEADRVGRNLVTEKYGRMMQSTYPQEYCANIAPYIPRISADRNVLQEGIITVQVSWARDFRER… |
| A0A0F2NMW5 | 13-182 | DQFIKNILEIEIENWNNAKIENRDERSLDGFITVRGTMFKTWSIGALESYYEDLCNYKRDNINIMTLKYARVGNLIPRINDNPLIDE… |
| A0A2M6ZV46 | 136-294 | None |
| R7D483 | 2-135 | None |
| A0A847YKE2 | 3-173 | None |
| A0A154BW62 | 5-139 | None |
| A0A3D3WBQ2 | 2-166 | None |
| A0A2N6EQJ4 | 4-189 | None |
| A0A7T8V4L5 | 3-196 | None |
| A0A1J4SN79 | 7-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.