DPCstruct | MC2692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 8.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q0X7A4 | 185-280 | IPVDASGRTLAQLVDVAEVNRRKPAYAYGIEDCDLCQRSLNEVKLFVDGGLRSQAGWVNMCPSCFEKHGHSIGWGKGQIYARQSNGR… |
| A0A7G7SWI3 | 5-105 | HAAAQALFVEYDKAADVLDESGPIWHGDIENCDVCSRPMEPEIYMIDGPAQASAQPMWGNMCVICAYKLSLKIEWGIAQLYRRQGSH… |
| A0A3E3IM24 | 50-151 | None |
| A0A174NCC2 | 367-467 | None |
| A0A7W2EMA8 | 385-478 | None |
| A0A2S4HT18 | 548-634 | None |
| A0A497WQP2 | 25-142 | None |
| A0A4R2NNM1 | 287-377 | None |
| A0A084U5R3 | 4-100 | None |
| G6E9H0 | 171-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.