DPCstruct | MC26917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 78 ± 11 aa |
| Standard deviation of domain lengths | 10.56 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532TH72 | 4-80 | ISGGDGFSFKEAIKISDCSNIEGVEQEYIEVRKKFGNYQLIRQSLQDKSGRMYDVLELKLEDGREITFYFDITDFFG |
| A0A844ZJC3 | 27-103 | DAPTVLASAGGTGPDDAYVVSSVAQEYEILRLLGLQSQSQEVHRIDGRTFDVLRVIDPQTQEARDVWFDISRFFGRG |
| A0A6G6RK04 | 71-151 | None |
| S3YCE8 | 38-108 | None |
| A0A4Q1EWA6 | 8-80 | None |
| A0A356WU31 | 91-158 | None |
| A0A8B3C640 | 176-242 | None |
| A0A1T1R938 | 4-101 | None |
| A0A1N7PC13 | 42-111 | None |
| A0A502DCZ9 | 91-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.