DPCstruct | MC26916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 8.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 63.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0516 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5PV20 | 3-68 | AHSSKTVLSLDSEAVLSLKDGINFKKSPDDAKCYIIYKENGELKACKNQCKHQGGLFIKDIEDLDG |
| Q5R781 | 1-95 | MSNRNDLSNCCSFKIPRQRNRQTMGSIEQTTEILLCLSPVEVANLKEGINFFRNKSTGKDYILYKNKSRLRACKNMCKHQGGLFIKD… |
| A0A3Q0DQL0 | 4-72 | None |
| A0A3Q2CQR3 | 1-88 | None |
| A0A4Z2BGU3 | 18-87 | None |
| A0A498P3D2 | 3-68 | None |
| J9P2P0 | 77-156 | None |
| A0A6P7D5Z3 | 3-71 | None |
| A0A671T6G6 | 1-69 | None |
| A0A1S3RT46 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.