DPCstruct | MC26914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 14.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416LGG9 | 129-255 | KGFLTPVYFKKEALAYFLAIPTYVVDIFSESYGYLEKVNSQGEAEWQVPFGFNSNGKWVMWLGDIDTIDEQTQAIIRAFNVESDHLL… |
| A0A2V8D6H9 | 81-204 | GGPYTARLAFGAPQLVPLFFELKVLATYFSDPRYHCKFWDSSGLISVSNEHYQSEAMPEKDKALLQSFGIGYDSNRNRVVAVFLRYL… |
| A0A496BHJ0 | 46-159 | None |
| A0A246EQ96 | 134-244 | None |
| A0A2W1AGU9 | 4-119 | None |
| A0A3A1P0S3 | 108-202 | None |
| A0A529HLG9 | 26-162 | None |
| R7PTE7 | 2-143 | None |
| C4ZIE2 | 103-227 | None |
| A0A4R4M3Y7 | 177-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.