DPCstruct | MC26912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 173 ± 26 aa |
| Standard deviation of domain lengths | 26.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 87.24 |
| Assigned Pfam label(s) | CL0244- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8CEF5 | 6-151 | DHGGVTNFGITAVAWGQYKKLNRPCTAAEMQAIARADAVEFYRQKYIVNSAFKAVAYEPLRAQLIDFAVNSGETRATRWLQRAIGLP… |
| A0A825BCJ3 | 12-136 | NADIRSASEVLYTNITLKKMVFDFYEREFWNKMRLNAIESQIIADELFCFGVNAGIKTAVKLAQKLVGTPLDGIMGVQTLRALNSAD… |
| A0A7X3UHW1 | 8-212 | None |
| A0A1F3EM28 | 4-137 | None |
| A0A3D5BUW8 | 63-278 | None |
| A0A1I5TV14 | 10-135 | None |
| A0A3P1W5B0 | 199-375 | None |
| A0A0X8JI06 | 20-227 | None |
| A0A258GU21 | 349-530 | None |
| A0A2A7U161 | 91-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.