DPCstruct | MC2691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 187 ± 24 aa |
| Standard deviation of domain lengths | 24.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1S7P6 | 9-198 | NTTKCALDAKNLEAFTQKSFSDLVYEAHSRGEDYYIARVQCSGTNGDPYFYCYDAKHLCKFVFEMVISAEGRRIRIKNFSDPIHSKD… |
| A0A177EE03 | 17-190 | IEPFTQRPFTEILKESKEKQLPHVLAKVFVKNVDKPTVYDARTLCKYLFELVISREGRTVRLKKVSDPIDDKIIKDIFFYEIPVNSQ… |
| S7XIK6 | 6-163 | None |
| A0A4Q9LJ20 | 107-260 | None |
| A0A0F9W9T1 | 14-188 | None |
| A0A1J5WSV3 | 21-238 | None |
| A0A1X0QBQ1 | 4-200 | None |
| A0A1R2CB24 | 37-228 | None |
| J9IE51 | 15-241 | None |
| A0A1Y2BRG7 | 95-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.