DPCstruct | MC26900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 140 ± 22 aa |
| Standard deviation of domain lengths | 22.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15983 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B2IP67 | 5-132 | WDIKKTQKLQKAVNQWGKAIGQSYRFYDGKRTLKTKNGPTYPDVLKKNRFLLNKKIIKIGYSLLGKNDYQYNVVAIANENFKSWHNT… |
| A0A6I2GWR5 | 404-549 | DVVNLWNDDKAKQLASFMATWGEGMGQTYQSFTPEAPGDMYGVSFPNDVLTALSVNETLVNASWSTTGEAAVEGEYVIVAAFNDVEH… |
| H3NIE5 | 218-350 | None |
| A0A2V1N022 | 145-275 | None |
| A0A4R5NBY8 | 67-228 | None |
| A0A0R1WY41 | 155-301 | None |
| H3NKR7 | 484-684 | None |
| A0A0R1U683 | 281-424 | None |
| A0A1S1BNY7 | 317-454 | None |
| A0A430AWZ1 | 65-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.