DPCstruct | MC2690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 12.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 35.25 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0123- CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1S3T6 | 39-99 | LDKSDAIDVLFKAFEKHGAWTVKDLADFTGQPVAYIQEIIGEIAVLDKKDYKNTYILKKQF |
| J9IIN4 | 208-274 | QPKEKRFAMDQGDLKMEIFGLFQKYYQYTLEDIQNILNQPRDPVKKVLEEICELNRNTRFYELKRSY |
| A0A5C5G5P1 | 302-371 | None |
| A0A6J1M3F0 | 26-95 | None |
| A0A1E3QJ13 | 307-402 | None |
| A0A2G9V1P2 | 80-157 | None |
| A0A0C3B8V3 | 114-180 | None |
| A0A367JJ02 | 185-276 | None |
| A0A7S0PSP9 | 108-173 | None |
| A0A7R9Y0U7 | 155-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.