DPCstruct | MC269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 133 ± 13 aa |
| Standard deviation of domain lengths | 12.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645GRL9 | 3-135 | HIPNLNLLFIDVEREVAESIFNLLNTSNKKRVFLLPSSTDFERYISTNEAIIIRPLISESPLQLIEDINTPTIEKVLVDIIGDVEFS… |
| A0A661ZU45 | 162-306 | LDLMLHIPVRSFYVFETEKDICEPAFYLFKDNGINAYYQPNQDQIDKYILPEENSIIVRPLISRAPYRTIEKTRIASIEKILVDLYC… |
| A0A4Q3F255 | 81-218 | None |
| A0A091CA65 | 2-110 | None |
| A0A7Y9I1C7 | 1-149 | None |
| A0A2N2PRR8 | 150-299 | None |
| A0A7V1UQ33 | 64-193 | None |
| A0A6C1P6G4 | 114-239 | None |
| A0A1V5QPK1 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.