DPCstruct | MC26899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 96.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 57.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2NAF4 | 1-67 | MRNGMTMIEPTGGIDTRNFLPILETCLDAGVAKVMPHVYSSIIDPHSGETRAEEVALLLEGIKQILR |
| A0A1C5PXX8 | 121-187 | AEACARNHFIMEPTGGIDLDNFREIMETILNAGVEKVIPHVYSSIIDKATGNTRIEDVKKLLAIVKE |
| A0A8B6J622 | 167-236 | None |
| D4ENG5 | 1-57 | None |
| A0A1Q2CLZ3 | 38-98 | None |
| A0A4U9HLH3 | 99-168 | None |
| A0A484XYK0 | 53-122 | None |
| A0A447PV75 | 1-71 | None |
| A0A1L8ZR42 | 35-90 | None |
| A0A7U1BUE4 | 75-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.