DPCstruct | MC26892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 151 ± 13 aa |
| Standard deviation of domain lengths | 12.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9BC90 | 40-195 | RIPKKLLPEIKYWKQLGFYLYNIDGDAVFYQAILPEGWYMQENGNSLRGIDIFDEKARIRGRIYYKASDFNPEAYAWLNPRYKLCEH… |
| A0A654C9M6 | 120-268 | LITLPVSIELPPGYQSAPRLREAMSRALAVKWVREGKDEVVAEFPEGWKATRPANGPIESRDPSGIVRALFGWAKDAELRVLPRYVI… |
| A0A0F9SJI1 | 44-193 | None |
| A0A1G2EFJ5 | 41-174 | None |
| A0A853QQD8 | 5-158 | None |
| A0A1F4VFD2 | 3-157 | None |
| A0A1G5P3K5 | 51-212 | None |
| K2FGR7 | 48-224 | None |
| A0A8B4ECF6 | 47-194 | None |
| A0A5E4S8I0 | 54-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.