DPCstruct | MC26891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 88 ± 12 aa |
| Standard deviation of domain lengths | 11.99 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.67 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0352- PF13780 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A096DK00 | 3-79 | LLPIGTIVLLKGFEKKIMIFGRKINRIQENKIYDYLGCFYPEGYIGDNYNIFFMHNSIDKIYFKGYEDSKEKIFRLQ |
| A0A7X9BC49 | 259-353 | LDTIEDIKDNFLPIGSIVKLKNIDKKVMVMGFCSISKEESGKVYDYSGCFYPEGYMAADKTCLFDNEDVEEVIAYGFKDEEEKSFKN… |
| A0A3D2JJ24 | 23-110 | None |
| A0A1S9SYV8 | 2-74 | None |
| C3DFZ7 | 1-62 | None |
| W7DDV9 | 1-69 | None |
| F2JHU0 | 124-211 | None |
| A0A3C0J9G9 | 3-87 | None |
| A0A0J8D698 | 3-70 | None |
| A0A2A5RXM3 | 3-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.