DPCstruct | MC2689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 4 aa |
| Standard deviation of domain lengths | 4.19 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U2X7Y2 | 354-442 | ESFFQIGDYENTDRKIHPLMIILSGDTLIKIDNNYKCYKRDDSGKINVSLNDTNNISDPPSKSHLINLNKKFPGTLISIRVFLNEHN… |
| K2EI70 | 12-99 | VQLIEAFQQLHRECAAGDTQEPSMAIISGSTHILFNGKYRMEKDSNGRHIIAFNEKNDLNDPPDEDCVTRLGDVAFPGTIVSLQFNLN |
| A0A376ZKT8 | 108-199 | None |
| B0NKQ9 | 2-90 | None |
| A0A0N1BHE4 | 70-158 | None |
| A0A4S5JEB6 | 395-473 | None |
| A0A2X3LT44 | 32-128 | None |
| A0A256A091 | 183-274 | None |
| A0A3Q8FRE1 | 2-93 | None |
| A0A3A5QIY4 | 213-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.