DPCstruct | MC26888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 201 ± 23 aa |
| Standard deviation of domain lengths | 22.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 30.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6H433 | 60-246 | LTSCSKGVAEPVLKDGLIPVKLSDDGTVTYADTSKVWYNYCDKVWANAVILNSGASYKVGDTIKESDIQSYFVWIPKYKYKLWNTGT… |
| R5HK34 | 841-1062 | TLTCTATGGNGNQAKATVSLVVKAMYADGSGANIPELYKNMVPIKYENNRWIVADLYSKWYDYNAKQWANAVVLNPGLTKAVGQEVT… |
| R5W9K0 | 177-362 | None |
| A0A1Q6V085 | 484-658 | None |
| R7M4J0 | 198-373 | None |
| R5SVK0 | 18-218 | None |
| A0A3D0Y7C7 | 779-1025 | None |
| R5TIE8 | 1-185 | None |
| R5HGR5 | 644-858 | None |
| R5HES7 | 1-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.