DPCstruct | MC26887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 283 ± 59 aa |
| Standard deviation of domain lengths | 59.32 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13830 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846WE79 | 18-192 | APTPALVDEVLSHLADAIGRDRAELAAARSPDRVLDLRRERTVWLLFQISTAQEEPVGAQDLALAVALLRDRTIRDIMYGLARSEYH… |
| A1SKY8 | 12-276 | ARIDLPPTRAEIPDAVETLLEPARAHGVGQAVFVIYSDDERLAAAVSRALCRSFTDVGVQVIWSLRADGSRWYPAHGSNPGVPVWGV… |
| A0A2L0N4A8 | 52-358 | None |
| A0A5C8JVW2 | 4-194 | None |
| A0A1X1N4A6 | 10-344 | None |
| A0A1S1BL83 | 45-300 | None |
| A0A022L128 | 1-320 | None |
| A0A7X9C9T0 | 12-377 | None |
| A0A847KHK9 | 42-323 | None |
| A0A124BV87 | 15-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.