DPCstruct | MC26884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 495 ± 104 aa |
| Standard deviation of domain lengths | 103.52 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395YK18 | 2-392 | TLKNWFSKFMIEDTKRRLWAVALVTLLFFFSFPVATVFVAGTRYSQDRIEWLRSFSRIMLTFVSKQNLWVAFIIVVLAIVCGVSGFS… |
| A0A3G9JV86 | 19-493 | NILTLLFLFLFQNFSAVYMLAALWVGLNAVVTSLFMQNDLHARDRLTLLSSLPVSRVSYFLQTYLVGLLFALLPPVICILGHLSPHL… |
| A0A1F8UR61 | 2-394 | None |
| A0A3B9K675 | 57-700 | None |
| A0A7C6YPI4 | 97-516 | None |
| A0A7X8MK30 | 8-666 | None |
| A0A252F2Y0 | 2-326 | None |
| A0A1Q6RKM6 | 61-582 | None |
| R6JYQ0 | 10-416 | None |
| A5Z9I2 | 7-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.