DPCstruct | MC26883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 103 ± 15 aa |
| Standard deviation of domain lengths | 14.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07949 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5GFL0 | 140-237 | HTEEAAVALRTQGQVAAGYRLDGEPIAEPGHVRLLARPEALAGLPRDALGEIVIQTAPIDLTGRNRTFQAYVDLVLPEEVELAPGVK… |
| A0A3G9J5B9 | 94-184 | TSGVTIKNVAVSVEGLKQGYEVSGIPSSVTVGLIGPSVDIYTTQLTKNYQVYADLSEYNTGSHNVTLKYRNFNNNLTVMIMPETANV… |
| A0A6D1GPZ6 | 5-104 | None |
| A0A7T9H8N1 | 4-118 | None |
| A0A3R6T519 | 7-111 | None |
| A0A3M1B5H6 | 16-135 | None |
| A0A2D9N0K1 | 60-164 | None |
| A0A2H6EL33 | 121-211 | None |
| W7B8E4 | 96-198 | None |
| A0A380ELV5 | 53-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.