DPCstruct | MC26877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 232 ± 19 aa |
| Standard deviation of domain lengths | 18.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812JRX9 | 2-217 | QECMDYMLSTGLAWRQRLQCECIGIHEQNRDGLGVSAGHVSELLSSILALGFVESECRGVCIELTSDSSSERTRLFNVRLAEESKGR… |
| A0A812ZTN2 | 229-455 | QSIVFEVQTIMDGEMPLNSKTEAILACLENAGLASKQRLLPRHLLIHPDNRSQSMLSYHDVWSKGLAMSMVGFNIKLVEGTTIAFAM… |
| A0A7S0KK68 | 3-266 | None |
| A0A812REB8 | 499-729 | None |
| A0A813FGR8 | 364-621 | None |
| A0A1Q9EMQ7 | 404-621 | None |
| A0A813AHZ5 | 1-241 | None |
| A0A813AZA5 | 1-227 | None |
| A0A1Q9C6K3 | 305-520 | None |
| A0A1Q9D1Z2 | 1-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.