DPCstruct | MC26875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 186 ± 24 aa |
| Standard deviation of domain lengths | 24.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4PZX0 | 70-283 | LEVVVNFHTVLVHIKRLASEADPRVPMLERIRAATSSACAVNAVLESDICLSFCGFTPAYSMIGRSVYTGFSPDLATVLCLQEQLDN… |
| A0A812YXX3 | 7-217 | EEAMSQLQLLRRLKLSICQGDGSFEERVSAAVAGLDDEKEKSPGGNSVAGLTVAIRSATQHWLGRDLHTPSRPLTEIRSVLEARQRL… |
| A0A812PZX6 | 4-167 | None |
| A0A812UE38 | 252-473 | None |
| A0A7S0AWQ0 | 1-170 | None |
| A0A812WDJ3 | 33-191 | None |
| A0A813E0R3 | 92-280 | None |
| A0A812VUQ8 | 269-453 | None |
| A0A813LUL4 | 530-736 | None |
| A0A7S4V6L6 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.