DPCstruct | MC26873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 538 ± 29 aa |
| Standard deviation of domain lengths | 29.47 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.75 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0126- CL0692- PF01822 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812THT0 | 492-1018 | AFEQHASWVASAFGDCTRICPESLKVPRPNLAFQQRHVTCNSTAGDPLPDLACEHLFKPRRFRRCHCGVIGCTEGCKSIDEVEDEIE… |
| A0A812YS16 | 1-536 | MRSCIWFVLVWHATNADDDIALLQIVGRTRSKELPLASWVVGPWGDCLAACGGSPVQVRKASCRSLTTGDLLASDKCPYVAPEPLRS… |
| A0A813ADG7 | 224-781 | None |
| A0A7S4QLE8 | 10-504 | None |
| A0A812NRC6 | 18-581 | None |
| A0A1Q9DRU4 | 134-678 | None |
| A0A7S1LRF4 | 92-663 | None |
| A0A812MQV1 | 22-573 | None |
| A0A7S2QCB6 | 9-515 | None |
| A0A7S4VJD1 | 10-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.