DPCstruct | MC26870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 499 ± 83 aa |
| Standard deviation of domain lengths | 82.87 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.73 |
| Pfam Score | 85.56 |
| Assigned Pfam label(s) | CL0376- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1GRS9 | 52-420 | QTDNITLTKTASKDVVALGEVVSYTVTIRNTGAEAINPTLTDAVPEGLVLQTRTISATIGEASAEENTLFWSGTLAGGAEARIIYSV… |
| A0A812Y6U6 | 338-923 | GAGIESLVLLDEFETVAFEENIQIQHRIENNAGVSAVPFALLGLEIDGVSVDLSGSVWNEISIGVFEAFIDDAQGNPIARIQREFVM… |
| A0A816VE59 | 80-522 | None |
| S9SDE9 | 31-636 | None |
| A0A6J4MWH3 | 34-562 | None |
| A0A388Q1H7 | 3-366 | None |
| A0A090Q366 | 58-567 | None |
| A0A7J4AYF4 | 1-498 | None |
| A0A1Z8QAZ9 | 53-611 | None |
| A0A3B9C4B9 | 43-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.