DPCstruct | MC2687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495T882 | 21-142 | LTKEGKDGRVVPYPSSGYLTKEGKDGRVIFYKSSGYLTKEGKDGRVIPYPSSGYLTKEGKDGRVVPYPSSGYLTKEGKDGRVVAYRS… |
| K2E7U1 | 1-108 | MVNISRTGKDGVEVSFPSTGYIYREGKDGRVVAFPSTGQIFREGKDGRVVAFPSTGYIYREGKDGRVVVFPSTGHIYREGKDGRVVA… |
| A0A1F7X005 | 96-201 | None |
| A0A1I7YWD6 | 155-285 | None |
| A0A542XLK0 | 64-182 | None |
| A0A840M684 | 11-114 | None |
| A0A7R9MXQ7 | 1-103 | None |
| A0A0W0ZF01 | 20-131 | None |
| A0A1I7ZIC6 | 109-209 | None |
| A4XCE6 | 199-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.