DPCstruct | MC26869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 215 |
|---|---|
| Mean domain length (aa) | 125 ± 27 aa |
| Standard deviation of domain lengths | 26.86 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.13 |
| Pfam Score | 99.35 |
| Assigned Pfam label(s) | CL0233- CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1JV48 | 4-101 | ANLMHSGVNVTCGDHIRLYLKTEPQGDDAVILDASWQGEGCAISVAAASFLTEEIKGMTLESARLLTKEDLFCWMGVELGPARVKCG… |
| A0A812Y1G2 | 565-667 | WEIGVGLVGAPECGDVMQLQIKVNDDTGIIEDAKFKCFGCGSAIASSSLATEWLRGKTLDEGLDIKNTEIVEELSLPPVKIHCSVLA… |
| A0A1V5C4E0 | 208-332 | None |
| A9T8W3 | 62-242 | None |
| A0A0K2REV8 | 3-91 | None |
| A0A847SVK3 | 133-242 | None |
| A0A6A6KXJ7 | 557-731 | None |
| A0A287XTP5 | 1-164 | None |
| A0A5N3WA71 | 23-156 | None |
| A0A849WSQ8 | 5-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.