DPCstruct | MC26868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 197 ± 22 aa |
| Standard deviation of domain lengths | 22.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812GZT4 | 22-228 | EPVTIVKATVIKGGHLKKQPWLPDLQLVGGVEYIKLHKWCRDLTLFVTGTALNFAATSKRPVHNINVQWFEDMKKKRQEACDAAVRK… |
| A0A812XJE5 | 16-232 | QPLKIYTATCISGGGLKGVWMPTIEEASGVTFIKLNKWDRQLTQYVTGKSLNLFSGSKKPKNSINVHWFQTMTDLRRQACNDSLKKL… |
| A0A1Q9E6R1 | 1-207 | None |
| A0A813AUY8 | 1-185 | None |
| A0A1Q9C2Q8 | 12-188 | None |
| A0A812LGI3 | 286-478 | None |
| A0A812M2T6 | 228-457 | None |
| A0A1Q9DWN8 | 297-482 | None |
| A0A1Q9D4X5 | 2-174 | None |
| A0A812VY05 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.