DPCstruct | MC26867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 506 ± 47 aa |
| Standard deviation of domain lengths | 46.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812KES5 | 39-484 | LLEELEQVLGAEHREAAEQRLHEFEDDLRITFKALPKNGRGAVAAPSARYALHRLFNQRHGWQIKGLETAAGAWDADSPVTAMGDRV… |
| A0A812XGR2 | 35-533 | LRETVLQEVMAALGTGNRVTDKRLQSIEAVLKPTFVAMPKNEHGKLEDAAARYVLHRLFVQRHAMQIKGLQADGMDWKNVTTSKVLE… |
| A0A1Q9EJN2 | 429-959 | None |
| A0A812NQU6 | 27-567 | None |
| A0A1Q9EGZ4 | 267-692 | None |
| A0A1Q9E6L4 | 282-811 | None |
| A0A7S2Q360 | 4-441 | None |
| A0A813AH30 | 738-1257 | None |
| A0A812V4D9 | 2-536 | None |
| A0A812XTW0 | 239-806 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.