DPCstruct | MC26865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 319 ± 39 aa |
| Standard deviation of domain lengths | 39.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I7LY61 | 139-470 | EYLFQKLPSSVLYMILSFLMNDYISIIMVSPLWYYKLHECIETELLKIDNDFIKSYSNALLFKNSYLTIKPIKVNNHFGFRMDRNIC… |
| A0A812XEB1 | 1-314 | MEAGMLPLVISFLFGGALIRCFEVCPLWFVVYYKTLDQVFSKIDKGFKQYYGQSLHLEYARTDWSPVHVAEAGIRIDRILIARVTSH… |
| A0A1J4MCU1 | 206-548 | None |
| A0A0V0QUG8 | 88-414 | None |
| A0BRR1 | 62-386 | None |
| G0QUB6 | 2-357 | None |
| Q7R8K0 | 171-505 | None |
| A0A0L7K8E2 | 3-219 | None |
| A0DWL3 | 15-329 | None |
| A0A078B3L5 | 378-765 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.