DPCstruct | MC26864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 685 ± 90 aa |
| Standard deviation of domain lengths | 90.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812KBB1 | 48-720 | SAVQRIYELGVYRDSQPGKLTHKEIAARWKASVTFSTITDADETMQDWAGFVSTCISVYDRCLSNPTVSRLILDAEERWGKQTPWDS… |
| A0A812XBS2 | 109-891 | TGVTIPVAMMQLEEMPAKGWDRYGADVAVAAYWYAFAQAKKQGSTETELQTWRALGRNVPMTFRFFPNEDAKFAAATEVVESVENNR… |
| A0A812YRE2 | 20-741 | None |
| A0A1Q9CED5 | 4-587 | None |
| A0A812TPM4 | 1-700 | None |
| A0A812SWI9 | 524-1225 | None |
| A0A812S5C1 | 32-862 | None |
| A0A812HGU5 | 39-648 | None |
| A0A1Q9DA98 | 275-814 | None |
| A0A812PZB6 | 6-733 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.