DPCstruct | MC26863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 293 ± 60 aa |
| Standard deviation of domain lengths | 60.34 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812X8R6 | 61-377 | DGRLPRQVPAGQVYAFAPLDPRQFGDLLRLGRQEAAAELARRGGPVMAAALAGQGNPPAPVAAGGVPQGAAPVIPGGPTTWVALEDV… |
| A0A813HU00 | 2-152 | ICEVPFDDWPLEGPRTMSYWCKELAKVNLDPVARHGTWRHDNTIRDDEKMGMQHEILSDILEQALCVDQLDVSNCASFECLVRHLQL… |
| A0A812PY67 | 33-392 | None |
| A0A813F2U5 | 14-225 | None |
| A0A813F9T6 | 4-272 | None |
| A0A812QD76 | 253-581 | None |
| A0A1Q9C5I0 | 75-428 | None |
| A0A812K6K2 | 9-387 | None |
| A0A813DKV3 | 1-208 | None |
| A0A813JTP9 | 89-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.