DPCstruct | MC26862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1129 |
|---|---|
| Mean domain length (aa) | 190 ± 40 aa |
| Standard deviation of domain lengths | 40.07 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.15 |
| Pfam Score | 90.30 |
| Assigned Pfam label(s) | CL0223- CL0023- CL0126- CL0020- CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G7Z7X5 | 32-215 | AADGPLASVSLWQGDLTALRVDAVVNAANSAMLGCFTPGHACVDNAIHTAAGPGLRAECADLVGAQGHPEPTGSAQVTGAYHLPARH… |
| A0A1U7SDX6 | 50-159 | EKVSLYRGDITLLEVDAIVNAANSSLLGGGGVDGCIHRAAGPCLVAECRNLSGCETGQAKITCGYDLPAKYVIHTVGPIARGHITDI… |
| A0A355U0A9 | 3-181 | None |
| A0A355RNB9 | 6-168 | None |
| A0A7C5NG33 | 5-192 | None |
| A0A2E4QX53 | 190-417 | None |
| A0A4Y7JTB8 | 13-191 | None |
| H0SW98 | 4-148 | None |
| A9JRH9 | 96-288 | None |
| A0A7Y1ZT93 | 391-576 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.