DPCstruct | MC2686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5010 |
|---|---|
| Mean domain length (aa) | 306 ± 70 aa |
| Standard deviation of domain lengths | 70.07 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.37 |
| Mean intra-cluster sequence similarity (%) | 11.64 |
| Pfam Score | 74.00 |
| Assigned Pfam label(s) | PF02729- CL0022- CL0113- CL0110- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2R1M7 | 70-298 | PVFSFSKTADYQDIMYPAWTFWEGGPAVWPIYPTGLGRWDLMMDDLKKSAAQWPWKNKESKGFFRGSRTSPERDPLILLSREAPELV… |
| A0A1H0AH69 | 17-317 | KITAERIKQGIENRSHKVSVISSTEEGAPIPENIDLVHGFHAYKFAIFQKKYNIHLPYILTLTGTDINQNLEEEDKRDVILQCLQNA… |
| A0A7R7GC75 | 27-319 | None |
| A0A7S1XWM6 | 257-466 | None |
| A0A419DWA1 | 328-668 | None |
| A0A3B9ZIS5 | 344-643 | None |
| A0A7W0Q936 | 43-298 | None |
| A0A418WTC5 | 16-346 | None |
| K8F6C7 | 744-1131 | None |
| A0A7R9Q310 | 39-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.