DPCstruct | MC26857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 129 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 65.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15281 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8BMJ6 | 219-346 | LDEMARLITVEEISPTSGLVSILKKRSVRLETLSTSVSSELLPENPTAKRRVRFRVPDDGYENDVGSGDSCLLLFLLCLVTVVISIG… |
| A0A6F9B465 | 12-144 | ASLDNLAKRITVEEMTPAPSLVSILKRRRMSVCVENVCVAPSSAPHKHHANRRVRFKVPDDGFDQDEVGGDSCLLLFLLCLVTVVIS… |
| A0A6I9NAA3 | 1-117 | None |
| G3NLC5 | 20-150 | None |
| A0A6P6R8Z7 | 138-275 | None |
| H3B194 | 380-501 | None |
| A0A0F8AQ18 | 302-447 | None |
| A0A665W9Z4 | 183-309 | None |
| A0A4W3JU42 | 141-263 | None |
| I7G8E4 | 56-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.