DPCstruct | MC26856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 12.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9B3A3 | 1-119 | MDSHAAEPGCNFEEVMSMLFTDAGTQEVNVHLVSETIQGVTATTTGIQYQQSWLCILCNVKSLQRRHVCISRLERPQNWGQNCCEVR… |
| F7BGU9 | 152-238 | KSFFTFQETYQDAMASVDHLKETIQGVSYKPDGADYEETWITALCTLPMVNKSHVAIARLRNPLNLGNKCEEVQFVIAIIAPKKEKF |
| A0A1I8JN68 | 205-313 | None |
| A0A1I8FHH5 | 155-238 | None |
| A0A182EKU2 | 53-153 | None |
| B3S4Z9 | 169-245 | None |
| A0A158QB25 | 362-462 | None |
| A0A673G5T9 | 42-139 | None |
| A0A3P7RW20 | 109-220 | None |
| A0A077ZH71 | 32-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.