DPCstruct | MC26855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 17.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0707 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5GML4 | 31-133 | NSRKMPSFVHPFPQPKAHVVKNRSGAECDICINVVQFVYSELKDNGTEEEIKQLLDKACSLLPGSSKQKCIDMVNNYLDMLVELIIQ… |
| A0A6F9B3A0 | 3-126 | TSLVLLALCLLACSVWEIHGQCQEVDPDDQEVVEAQPEKHMEQQLMGTCRVCKWALNKVKKSISTSSRQEEVKQKLLSICNKVPFGK… |
| H3C3Q8 | 5-96 | None |
| A0A5A9NLG3 | 7-126 | None |
| A0A498LVI7 | 1-156 | None |
| A0A7J5Y7C0 | 1-126 | None |
| A0A6B0R2T7 | 202-323 | None |
| A0A3Q2HCW5 | 152-275 | None |
| A0A3Q2HC68 | 151-276 | None |
| A0A663EDJ1 | 97-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.