DPCstruct | MC26854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05404 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9J7J3 | 151-246 | AARTGDDKYQVSWTEEVKKARSGDYSVNLFDDEGYAALRKAVRSGEDASTVKPLVTVVVNYPGAYQGPWVNSEFMAAVLSLLVWYLA… |
| A0A6F9B2Q9 | 36-130 | VISSESVFIVSWSMPHKQASSGTYQVKFFDEESYSSLRKAQRNNEDVESIQPLFSVNVDHRGAWNGPWVPTEVMAALIGILVYYLAF… |
| T1H2G9 | 67-159 | None |
| A0A0N1IF59 | 199-295 | None |
| T1EFS1 | 70-165 | None |
| A0A818CFT4 | 944-1041 | None |
| A0A368FFE4 | 2-88 | None |
| A0A6P7FCI1 | 14-109 | None |
| A0A6G0ZEW3 | 136-231 | None |
| A0A819MII0 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.