DPCstruct | MC26852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 9.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 54.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03747 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0JBX9 | 280-375 | YKAAMVLSGVGDALGYRAGRWEYCTSGPQIHAELAELGGLAAISLEPPEWPVSDDTVLHLATAEGLATGLEGEPLLQELARRYVAAM… |
| A0A6F9AY70 | 7-92 | LEERYKASMVLSGAGDALGYNHGNWEFEKDGAFIHEEVQKRGGLEKLDAIDFPVSDDTIMHLATAEALVKLGFGEGASLPVLYQAM |
| A0A7J7ZXJ8 | 14-105 | None |
| A0A7J5YZQ9 | 17-105 | None |
| A0A813YJL8 | 1-110 | None |
| A0A7J6AR81 | 8-106 | None |
| A0A498M566 | 2-92 | None |
| A0A556TKC8 | 246-340 | None |
| A0A4W3GWR9 | 1-73 | None |
| A0A7R5KIB8 | 8-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.