DPCstruct | MC2685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 199 ± 27 aa |
| Standard deviation of domain lengths | 26.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A269Z4A8 | 270-469 | LLAPAAATERMRTLAVLDAICTSARPRYTCTSTDGVTIARLDDGGGDWFGIAQTADGVLLRAFDHESPMNIAETGAVWPGLLEGLSP… |
| A0A1A9R7E5 | 3-182 | EELRKKLKTLALLDAVIEQEWQYRYFSYNSHWSDSEEMGSLRDGCGGEWFLWISGDLAGYKCLSPEDGLMPDLKEAIERVPSAYENF… |
| A0A1A2B9S3 | 309-506 | None |
| A0A7X0G543 | 1-219 | None |
| A0A328NT65 | 292-508 | None |
| A0A243RPW0 | 1-154 | None |
| A0A4R6KRP3 | 2-220 | None |
| A0A387HCB9 | 6-161 | None |
| A0A0N1GVS8 | 11-206 | None |
| A0A7J0CWA8 | 21-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.