DPCstruct | MC26849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 255 ± 21 aa |
| Standard deviation of domain lengths | 20.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6NY95 | 1-276 | MRTKGNESVYSEFEKLMQENRCQQAAELLREKKGISALLRNMDYIISRMDREDEQTFLSEFPEDCSTLILLQLLFRYEGVQRKDGRI… |
| A0A7T4U0C4 | 187-463 | TWQSRVEDALGRWDTTAAARLLGERPGELLRRLDLLLARSGSATLPEPVAEALARALPHTASGPLLGAYGQLMIRTAPGRRRVFFPR… |
| A0A1H1GUN9 | 74-340 | None |
| A0A1Q3N3R6 | 353-587 | None |
| A0A7Z0TH74 | 1-222 | None |
| A0A563VYI6 | 38-297 | None |
| H8H253 | 442-721 | None |
| A0A6S6UMK4 | 1-238 | None |
| A0A7S2D9B4 | 127-371 | None |
| A0A7X8X1K2 | 316-578 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.